PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_D6F52AD28.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 211aa    MW: 23374.4 Da    PI: 10.2723
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_D6F52AD28.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.83.2e-3548106260
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                            ++++l+cprC st+tkfCyynnys++qPr++C++CrryWt+GG+lr vPvGg++r+   
  Traes_2AL_D6F52AD28.2  48 QQQKLECPRCSSTDTKFCYYNNYSTTQPRHYCRTCRRYWTHGGTLRKVPVGGACRRGSG 106
                            7899***************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.2E-3150104IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2052100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.44752106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MAPASASLLP AASAKRPFAP DSATDAAEKE QPLDQESAVT KKNGQNQQQQ KLECPRCSST  60
DTKFCYYNNY STTQPRHYCR TCRRYWTHGG TLRKVPVGGA CRRGSGSSSK RRRSFAEPHT  120
PSSGSPPPPQ PKQQDTLXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXSPPPAL GTTSAASCSP ARRLLGTDQR H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3715001e-126AK371500.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2135N06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448779.12e-36hypothetical protein SORBIDRAFT_06g033010
TrEMBLW5AXH41e-108W5AXH4_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.15e-26DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]